PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00274.1.g00350.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 402aa    MW: 42158.7 Da    PI: 4.6374
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00274.1.g00350.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.23.8e-17950142
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  k+ienk++rq  + kRr+++l KA+EL +LCd+ vav+i+ +
  Zpz_sc00274.1.g00350.1.am.mk  9 KFIENKRRRQSALRKRRATLLEKAKELATLCDVAVAVVIYCQ 50
                                  79*************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.245148IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-15160IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-5323IPR002100Transcription factor, MADS-box
CDDcd002662.11E-19683No hitNo description
SuperFamilySSF554557.98E-17685IPR002100Transcription factor, MADS-box
PfamPF003191.9E-141049IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MAPSPLKIKF IENKRRRQSA LRKRRATLLE KAKELATLCD VAVAVVIYCQ GEAEAVTWPS  60
AAETKTILER FVALPDVAKA NMNIEAFMQS RVEKVTKVLD NLKQGNCTQQ TYLVLNAIRN  120
GDRLNLDDLP PELAAAVKEA YAARMNLVAR HIRNPVAQAT AAAPLPPADA ATLAPAAPQL  180
PFMLPSLPET GYEAHRNVVA SYLNSLAAQA TSAAPPPPAD AAVLAQAPQE PFVLPPLSES  240
AYVAEMNLVA SYINNLAAQA TSAAPPPPAD AALVPGPQEP LVPPPLTMAP MAVTDEHAPL  300
VAPPLALEAV VADTQAPLVA PPLALEAVVA DALAPLVAPP LAATPPVVPD TPAPSLQMDL  360
DGKPLPDSFL AEMVAAIMDD GSGSNVAPTD DDVQRIRKQH GL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2815634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-09AGAMOUS-like 48